Skip to content
Sale

Influencer Marketing Academy 2.0 (2017) – Dan DaSilva

Rated 0 out of 5
(be the first to review)

Original price was: $1,297.00.Current price is: $144.00.

We’ve Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In Prizes

Category:

Description

Unlock your potential with the Unlock your potential with the Influencer Marketing Academy 2.0 (2017) – Dan DaSilvaInfluencer Marketing Academy 2.0 (2017) – Dan DaSilva course for only course for only Original price was: $1,297.00.Original price was: $1,297.00.Current price is: $144.00.Current price is: $144.00. at at Giolib.comGiolib.com! Explore our comprehensive library of over 60,000 downloadable digital courses across various ! Explore our comprehensive library of over 60,000 downloadable digital courses across various Digital MarketingDigital Marketing. Get expert-led, self-paced learning at up to 80% savings. Elevate your skills today!. Get expert-led, self-paced learning at up to 80% savings. Elevate your skills today!

Hottest Topic Of 2017…Hottest Topic Of 2017…

We’ve Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In PrizesWe’ve Tapped Into A Goldmine Using Influencers That Everyone Has Been DYING To Learn About… Now You Get $648 Per Sale and Over $60,000 In Prizes

3 Months Of Intensive Training and $140K Later…3 Months Of Intensive Training and $140K Later…

So what isInfluencer Marketing AcademySo what isInfluencer Marketing Academy

We set out on a mission in early 2016 and trying to find the BIGGEST influencer…We set out on a mission in early 2016 and trying to find the BIGGEST influencer…

At the CHEAPEST price.At the CHEAPEST price.

Being able to tap into millions of people to build our lists and eCommerce brands…Being able to tap into millions of people to build our lists and eCommerce brands…

We saw TONS of people shortcutting their success, but we didn’t understand HOWWe saw TONS of people shortcutting their success, but we didn’t understand HOW

Until one day it struck me…Until one day it struck me…

INFLUENCERS!INFLUENCERS!

People are paying others to sponsor their brand and grow their eCommerce stores and help them build a massive list. I decided to reach out to 6 Influencers so they can ‘sponsor’ our product and WOW.People are paying others to sponsor their brand and grow their eCommerce stores and help them build a massive list. I decided to reach out to 6 Influencers so they can ‘sponsor’ our product and WOW.

I didn’t have to EVER have to pay based on every 1,000 impressions.. or heck.. I didn’t even have to pay per click! I was paying for a POST! These posts ranged from $30 – $300 depending how big their following was.I didn’t have to EVER have to pay based on every 1,000 impressions.. or heck.. I didn’t even have to pay per click! I was paying for a POST! These posts ranged from $30 – $300 depending how big their following was.

Lone and behold I ended up spending $2,000 in a single day to generate over $14,200 back! Now THATS not an ROI to bat an eyelash at… and not only that but that ROI was made in the SAME DAY!Lone and behold I ended up spending $2,000 in a single day to generate over $14,200 back! Now THATS not an ROI to bat an eyelash at… and not only that but that ROI was made in the SAME DAY!

We are able to do this day in and day out. Over and over again. Without failure. So 9 months later… And over $90,000 worth of testing… We are releasing the most anticipated course ever…We are able to do this day in and day out. Over and over again. Without failure. So 9 months later… And over $90,000 worth of testing… We are releasing the most anticipated course ever…

Influencer Marketing Academy.Influencer Marketing Academy.

IMA is SUPER easy to use and , ANYONE can implement this system. The students we currently have using this system are generating THOUSANDS of dollars with our simple influencer system.IMA is SUPER easy to use and , ANYONE can implement this system. The students we currently have using this system are generating THOUSANDS of dollars with our simple influencer system.

Your students will LOVE Influencer Marketing Academy and how IN DEPTH we get. We DIVE DEEP into the entire system and show you EVERYTHING. Over the shoulder examples, case studies and YES…. we even provide them with done for you swipe templates to use to contact their desired influencer and the PERFECT image template to upload and send once they find an influencer.Your students will LOVE Influencer Marketing Academy and how IN DEPTH we get. We DIVE DEEP into the entire system and show you EVERYTHING. Over the shoulder examples, case studies and YES…. we even provide them with done for you swipe templates to use to contact their desired influencer and the PERFECT image template to upload and send once they find an influencer.

Watch this super short 2 minute video to get a quick sneak peak at whats inside and what we’ve been working so hard on…Watch this super short 2 minute video to get a quick sneak peak at whats inside and what we’ve been working so hard on…

Here Are the Exact Dates To Help Schedule Your MailingsHere Are the Exact Dates To Help Schedule Your Mailings

  • January 3rd – Free Book Released + Free Video #1January 3rd – Free Book Released + Free Video #1
  • January 5th – 2rd Video Released + Workshop InviteJanuary 5th – 2rd Video Released + Workshop Invite
  • January 7th – 3rd Video Released + Workshop InviteJanuary 7th – 3rd Video Released + Workshop Invite
  • January 8th – 4th Micro Video Released + Workshop InviteJanuary 8th – 4th Micro Video Released + Workshop Invite
  • January 9th – 1st Workshop / Cart OpenJanuary 9th – 1st Workshop / Cart Open
  • January 10th – 1st Workshop EncoreJanuary 10th – 1st Workshop Encore
  • January 12th – Second WorkshopJanuary 12th – Second Workshop
  • January 13th – Second Workshop EncoreJanuary 13th – Second Workshop Encore
  • January 14th – Last Workshop InvitationJanuary 14th – Last Workshop Invitation
  • January 15th – Last Workshop InvitationJanuary 15th – Last Workshop Invitation
  • January 16th – Last Workshop + Cart ClosingJanuary 16th – Last Workshop + Cart Closing

The Fine PrintThe Fine Print

As an Affiliate you agree to the following:As an Affiliate you agree to the following:

The new FTC Guidelines for affiliate marketing came into effect on December 1st 2009. As an affiliate or JV partner for ‘Influencer Marketing Academy’, you’ve read and fully agree to the terms listed on the Official FTC Website – http://www.ftc.gov/bcp/guides/guides.shtm to ensure that your promotions are compliant with the new guidelines.The new FTC Guidelines for affiliate marketing came into effect on December 1st 2009. As an affiliate or JV partner for ‘Influencer Marketing Academy’, you’ve read and fully agree to the terms listed on the Official FTC Website – http://www.ftc.gov/bcp/guides/guides.shtm to ensure that your promotions are compliant with the new guidelines.

ABSOLUTELY NO NEGATIVE MARKETING. No “This is a Scam” and turning around to promote the product with your affiliate link. This will not only get ALL commissions negated. You will not be allowed to promote any future products from our company.ABSOLUTELY NO NEGATIVE MARKETING. No “This is a Scam” and turning around to promote the product with your affiliate link. This will not only get ALL commissions negated. You will not be allowed to promote any future products from our company.

Also, if not removed immediately, we reserve the right to take legal action. We’re not trying to be unfair or crude, but guys, come on, we have a right to protect our brand. That kind of marketing doesn’t help anyone and isn’t fair to our company. Of course you’re entitled to your opinion, but we still have the right to protect how our affiliate links are used ?Also, if not removed immediately, we reserve the right to take legal action. We’re not trying to be unfair or crude, but guys, come on, we have a right to protect our brand. That kind of marketing doesn’t help anyone and isn’t fair to our company. Of course you’re entitled to your opinion, but we still have the right to protect how our affiliate links are used ?

We have a minimum threshold of $200 in commissions for our monthly payout..We have a minimum threshold of $200 in commissions for our monthly payout..

To be eligible for any lead prize, your conversion to sales must not be significantly below the average. This is at our sole discretionTo be eligible for any lead prize, your conversion to sales must not be significantly below the average. This is at our sole discretion

Payment will be processed on the 20th of Each Month for the sales generated 2 month prior. You will be paid in FULL.Payment will be processed on the 20th of Each Month for the sales generated 2 month prior. You will be paid in FULL.

As an affiliate, if you purchase the product under your own link, we will VOID YOUR COMMISSIONS.As an affiliate, if you purchase the product under your own link, we will VOID YOUR COMMISSIONS.

Affiliate sales must qualify as legitimate transactions based on our terms and conditions. All transactions will be monitored and automatically reviewed. If any sales transactions associated with your affiliate ID and/or account do not line up with the types of qualified sales most typically seen through normal traffic generation methods, our system will flag your account. This will trigger a manual review of your transactions, and if necessary your sites and traffic practices. Any questionable transactions will be investigated. We reserve the right to withhold payment of commissions until the review process is completed. If, after a manual review, any transactions are deemed questionable, any earned commissions on those transactions could be invalidated and you may not be paid for them.Affiliate sales must qualify as legitimate transactions based on our terms and conditions. All transactions will be monitored and automatically reviewed. If any sales transactions associated with your affiliate ID and/or account do not line up with the types of qualified sales most typically seen through normal traffic generation methods, our system will flag your account. This will trigger a manual review of your transactions, and if necessary your sites and traffic practices. Any questionable transactions will be investigated. We reserve the right to withhold payment of commissions until the review process is completed. If, after a manual review, any transactions are deemed questionable, any earned commissions on those transactions could be invalidated and you may not be paid for them.

Affiliates are not permitted to do use any keyword based advertising (such as search engine PPC) targetting a keyword of any of Dan Dasilva / Influencer Marketing Academy brands (For example, you may not target the keyword “Influencer Marketing Academy” in your PPC campaign)Affiliates are not permitted to do use any keyword based advertising (such as search engine PPC) targetting a keyword of any of Dan Dasilva / Influencer Marketing Academy brands (For example, you may not target the keyword “Influencer Marketing Academy” in your PPC campaign)

Affiliates are not permitted to use domain names containing any of Dan Dasilva / Influencer Marketing Owned brands to promote. For example, you may not use influencermarketingacademyreview.net, because it has the term “InfluencerMarketingAcademy” in it, which is one of our brands.Affiliates are not permitted to use domain names containing any of Dan Dasilva / Influencer Marketing Owned brands to promote. For example, you may not use influencermarketingacademyreview.net, because it has the term “InfluencerMarketingAcademy” in it, which is one of our brands.

You may not give away any of OUR material (for example eBook or report) under any circumstances without prior written consent. (for example, you may not collect an email address in exchange for our eBook).You may not give away any of OUR material (for example eBook or report) under any circumstances without prior written consent. (for example, you may not collect an email address in exchange for our eBook).

Please make sure that your review/bonus site does not accidentally (or purposely) represent as us in any way – so using our logo on your page is probably fine, but in your header, maybe not – use your discretion.Please make sure that your review/bonus site does not accidentally (or purposely) represent as us in any way – so using our logo on your page is probably fine, but in your header, maybe not – use your discretion.

You may not use your affiliate link on any of OUR pages (such as comments section)You may not use your affiliate link on any of OUR pages (such as comments section)

We don’t allow cashbacks, rebates, giftcards, ipads etc.. Information product bonuses are allowed and encouraged.We don’t allow cashbacks, rebates, giftcards, ipads etc.. Information product bonuses are allowed and encouraged.

During further review you may be asked for the following:During further review you may be asked for the following:

Your full nameYour full name

Your phone number (in case we need to interview you)Your phone number (in case we need to interview you)

Method of promo (i.e.: email marketing, Facebook, Solo, Blog, etc)Method of promo (i.e.: email marketing, Facebook, Solo, Blog, etc)

Proof of Proof of method(s) used to promo ( snapshot of email list, Facebook ad, solo ad receipt, blog display, website, etc)Proof of Proof of method(s) used to promo ( snapshot of email list, Facebook ad, solo ad receipt, blog display, website, etc)


Tag: Influencer Marketing Academy 2.0 (2017) – Dan DaSilva Review. Influencer Marketing Academy 2.0 (2017) – Dan DaSilva download. Influencer Marketing Academy 2.0 (2017) – Dan DaSilva discount.Tag: Influencer Marketing Academy 2.0 (2017) – Dan DaSilva Review. Influencer Marketing Academy 2.0 (2017) – Dan DaSilva download. Influencer Marketing Academy 2.0 (2017) – Dan DaSilva discount.

Future-proof your knowledge with the Future-proof your knowledge with the Influencer Marketing Academy 2.0 (2017) – Dan DaSilvaInfluencer Marketing Academy 2.0 (2017) – Dan DaSilva course at course at GiOlibGiOlib! Enjoy lifetime access to high-quality digital content, crafted to advance your career and personal development.! Enjoy lifetime access to high-quality digital content, crafted to advance your career and personal development.

  • Lifetime Access:Lifetime Access: Permanent access to all purchased courses. Permanent access to all purchased courses.
  • Smart Savings:Smart Savings: Benefit from prices up to 80% off original course costs. Benefit from prices up to 80% off original course costs.
  • Safe Transactions:Safe Transactions: Process your payments securely. Process your payments securely.
  • Practical Insights:Practical Insights: Gain actionable skills relevant to today's demands. Gain actionable skills relevant to today's demands.
  • Instant Availability:Instant Availability: Begin your course immediately after payment. Begin your course immediately after payment.
  • Flexible Learning:Flexible Learning: Access content effortlessly on any device. Access content effortlessly on any device.

Start expanding your horizons with Start expanding your horizons with GiOlibGiOlib!!

Reviews

There are no reviews yet.

Leave a customer review
Cart
Back To Top